Recombinant Human Protein FAM19A4 (FAM19A4), C-terminal human IgG1 Fc with an LALAPG Fc silencing mutation, Mammalian expression - 100 ug

https://www.gentaur.be/web/image/product.template/14654/image_1920?unique=2a20a7d
(0 review)

Uniprot: Q96LR4
Expression Region: 36-140 AA
Sequence of the he sequence of the C-terminal human IgG1 Fc with an LALAPG Fc is:
PKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

£ 0.00 0.0 GBP £ 0.00 VAT Excluded

2,380.00 € VAT Excluded

info@gentaur.com

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days