PLTR- RD114A, 2 ug
(0 review)

£ 313.65 313.65000000000003 GBP £ 313.65 VAT Excluded

369.00 € VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Catalog No. PVT11102
    Packing 2ug


    pLTR-RD114A Information

    Prokaryotic resistance: kanamycin Kan

    Screening markers: Mycophenolate G418

    Cloned strain: Escherichia coli Stbl3

    Culture conditions: 37 degrees centigrade


    pLTR-RD114A Description

    PLTR-RD114A is used to protein expression.


    pLTR-RD114A Sequence


    LOCUS       Exported                6258 bp ds-DNA     circular SYN 03-NOV-2017DEFINITION  synthetic circular DNAFEATURES             Location/Qualifiers     source          1..6258                     /organism="synthetic DNA construct"                     /mol_type="other DNA"     polyA_signal    3046..3167                     /label=SV40 poly(A) signal                     /note="SV40 polyadenylation signal"     rep_origin      complement(3174..3629)                     /direction=LEFT                     /label=f1 ori                     /note="f1 bacteriophage origin of replication; arrow                      indicates direction of (+) strand synthesis"     promoter        3656..3760                     /gene="bla"                     /label=AmpR promoter     promoter        3762..4119                     /label=SV40 promoter                     /note="SV40 enhancer and early promoter"     rep_origin      3970..4105                     /label=SV40 ori                     /note="SV40 origin of replication"     CDS             4154..4948                     /codon_start=1                     /gene="aph(3')-II (or nptII)"                     /product="aminoglycoside phosphotransferase from Tn5"                     /label=NeoR/KanR                     /note="confers resistance to neomycin, kanamycin, and G418                      (Geneticin(R))"                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"     polyA_signal    5180..5227                     /label=HSV TK poly(A) signal                     /note="herpes simplex virus thymidine kinase                      polyadenylation signal (Cole and Stacy, 1985)"     rep_origin      5556..6144                     /direction=RIGHT                     /label=ori                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of                      replication"ORIGIN        1 tagttattac cggactcaga tctcgagacc tagaaaaaca tggagcaatc acaagtagca       61 atacagcagc taacaatgct gcttgtgcct ggctagaagc acaagaggag gaagaggtgg      121 gttttccagt cacacctcag gtacctttaa gaccaatgac ttacaaggca gctgtagatc      181 ttagccactt tttaaaagaa aaggggggac tggaagggct aattcactcc caaagaagac      241 aagatatcct tgatctgtgg atctaccaca cacaaggcta cttccctgat tggcagaact      301 acacaccagg gccaggggtc agatatccac tgacctttgg atggtgctac aagctagtac      361 cagttgagcc agataaggta gaagaggcca ataaaggaga gaacaccagc ttgttacacc      421 ctgtgagcct gcatggaatg gatgaccctg agagagaagt gttagagtgg aggtttgaca      481 gccgcctagc atttcatcac gtggcccgag agctgcatcc ggagtacttc aagaactgct      541 gacatcgagc ttgctacaag ggactttccg ctggggactt tccagggagg cgtggcctgg      601 gcgggactgg ggagtggcga gccctcagat gctgcatata agcagctgct ttttgcctgt      661 actgggtctc tctggttaga ccagatctga gcctgggagc tctctggcta actagggaac      721 ccactgctta agcctcaata aagctgatcc cccgggctgc aggaatttat gaaatccttt      781 atgggggacc cccccctttg tcaaccttgc tcaattcctt ctccccctcc gatcctaaga      841 ctgatttaca agcccgacta aaagggctgc aaggcgtgca ggcccaaatc tggacacccc      901 tggccgaatt gtaccggcca ggacatccac aaactagcca cccatttcag gtgggagact      961 ccgtgtacgt ccggcggcac cgctctcaag gattggagcc tcgttggaag ggaccttaca     1021 tcgtcctgct gaccacgccc accgccataa aggttgacgg gatcgccgcc tggattcacg     1081 catcgcacgc caaggcagcc ccaaaaaccc ctggaccaga aactcccaaa acctggaagc     1141 tccgccgttc ggagaaccct cttaagataa gactctcccg tgtctgactg ctaatccacc     1201 ttgtccctgt actaacccaa aatgaaactc ccaacaggaa tggtcatttt atgtagccta     1261 ataatagttc gggcagggtt tgacgacccc cgcaaggcta tcgcattagt acaaaaacaa     1321 catggtaaac catgcgaatg cagcggaggg caggtatccg aggccccacc gaactccatc     1381 caacaggtaa cttgcccagg caagacggcc tacttaatga ccaaccaaaa atggaaatgc     1441 agagtcactc caaaaaatct cacccctagc gggggagaac tccagaactg cccctgtaac     1501 actttccagg actcgatgca cagttcttgt tatactgaat accggcaatg cagggcgaat     1561 aataagacat actacacggc caccttgctt aaaatacggt ctgggagcct caacgaggta     1621 cagatattac aaaaccccaa tcagctccta cagtcccctt gtaggggctc tataaatcag     1681 cccgtttgct ggagtgccac agcccccatc catatctccg atggtggagg acccctcgat     1741 actaagagag tgtggacagt ccaaaaaagg ctagaacaaa ttcataaggc tatgcatcct     1801 gaacttcaat accacccctt agccctgccc aaagtcagag atgaccttag ccttgatgca     1861 cggacttttg atatcctgaa taccactttt aggttactcc agatgtccaa ttttagcctt     1921 gcccaagatt gttggctctg tttaaaacta ggtaccccta cccctcttgc gatacccact     1981 ccctctttaa cctactccct agcagactcc ctagcgaatg cctcctgtca gattatacct     2041 cccctcttgg ttcaaccgat gcagttctcc aactcgtcct gtttatcttc ccctttcatt     2101 aacgatacgg aacaaataga cttaggtgca gtcaccttta ctaactgcac ctctgtagcc     2161 aatgtcagta gtcctttatg tgccctaaac gggtcagtct tcctctgtgg aaataacatg     2221 gcatacacct atttacccca aaactggaca ggactttgcg tccaagcctc cctcctcccc     2281 gacattgaca tcatcccggg ggatgagcca gtccccattc ctgccattga tcattatata     2341 catagaccta aacgagctgt acagttcatc cctttactag ctggactggg aatcaccgca     2401 gcattcacca ccggagctac aggcctaggt gtctccgtca cccagtatac aaaattatcc     2461 catcagttaa tatctgatgt ccaagtctta tccggtacca tacaagattt acaagaccag     2521 gtagactcgt tagctgaagt agttctccaa aataggaggg gactggacct actaacggca     2581 gaacaaggag gaatttgttt agccttacaa gaaaaatgct gtttttatgc taacaagtca     2641 ggaattgtga gaaacaaaat aagaacccta caagaagaat tacaaaaacg cagggaaagc     2701 ctggcatcca accctctctg gaccgggctg cagggctttc ttccgtacct cctacctctc     2761 ctgggacccc tactcaccct cctactcata ctaaccattg ggccatgcgt tttcaatcga     2821 ttggtccaat ttgttaaaga caggatctca gtggtccagg ctctggtttt gactcagcaa     2881 tatcaccagc taaaacccat agagtacgag ccatgaagat ccaccggatc tagataactg     2941 atcataatca gccataccac atttgtagag gttttacttg ctttaaaaaa cctcccacac     3001 ctccccctga acctgaaaca taaaatgaat gcaattgttg ttgttaactt gtttattgca     3061 gcttataatg gttacaaata aagcaatagc atcacaaatt tcacaaataa agcatttttt     3121 tcactgcatt ctagttgtgg tttgtccaaa ctcatcaatg tatcttaacg cgtaaattgt     3181 aagcgttaat attttgttaa aattcgcgtt aaatttttgt taaatcagct cattttttaa     3241 ccaataggcc gaaatcggca aaatccctta taaatcaaaa gaatagaccg agatagggtt     3301 gagtgttgtt ccagtttgga acaagagtcc actattaaag aacgtggact ccaacgtcaa     3361 agggcgaaaa accgtctatc agggcgatgg cccactacgt gaaccatcac cctaatcaag     3421 ttttttgggg tcgaggtgcc gtaaagcact aaatcggaac cctaaaggga gcccccgatt     3481 tagagcttga cggggaaagc cggcgaacgt ggcgagaaag gaagggaaga aagcgaaagg     3541 agcgggcgct agggcgctgg caagtgtagc ggtcacgctg cgcgtaacca ccacacccgc     3601 cgcgcttaat gcgccgctac agggcgcgtc aggtggcact tttcggggaa atgtgcgcgg     3661 aacccctatt tgtttatttt tctaaataca ttcaaatatg tatccgctca tgagacaata     3721 accctgataa atgcttcaat aatattgaaa aaggaagagt cctgaggcgg aaagaaccag...//
    1.  This product is FOR RESEARCH USE ONLY!
    2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.