pRPR1_gRNA_handle_RPR1t, 2 ug
(0 review)

£ 297.50 297.5 GBP £ 297.50 VAT Excluded

350.00 € VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Catalog No. PVT11276
    Packing 2ug


    pRPR1_gRNA_handle_RPR1t Information

    Promoter: RPR1 promoter

    Prokaryotic resistance: ampicillin Amp

    Screening markers: LEU2

    Cloned strain: Escherichia coli DH5 alpha

    Culture conditions: 37 degrees centigrade



    pRPR1_gRNA_handle_RPR1t Description

    PRPR1_gRNA_handle_RPR1t is a yeast cell gene editing gRNA expression plasmid.



    pRPR1_gRNA_handle_RPR1t Sequence

    LOCUS       Exported                7693 bp ds-DNA     circular SYN 29-DEC-2017DEFINITION  synthetic circular DNAFEATURES             Location/Qualifiers     source          1..7693                     /organism="synthetic DNA construct"                     /mol_type="other DNA"     rep_origin      69..1411                     /label=2u ori                     /note="yeast 2u plasmid origin of replication"     protein_bind    401..448                     /label=FRT                     /bound_moiety="FLP recombinase from the Saccharomyces                      cerevisiae 2u plasmid"                     /note="FLP-mediated recombination occurs in the 8-bp core                      sequence TCTAGAAA (Turan and Bode, 2011)."     promoter        1438..1542                     /gene="bla"                     /label=AmpR promoter     CDS             1543..2403                     /codon_start=1                     /gene="bla"                     /product="beta-lactamase"                     /label=AmpR                     /note="confers resistance to ampicillin, carbenicillin, and                     related antibiotics"                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS                     LIKHW"     rep_origin      2574..3162                     /direction=RIGHT                     /label=ori                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of                      replication"     promoter        3626..4032                     /gene="RPR1"                     /label=RPR1 promoter                     /note="promoter for the S. cerevisiae RNase P RNA gene"     misc_RNA        4040..4115                     /label=gRNA scaffold                     /note="guide RNA scaffold for the Streptococcus pyogenes                      CRISPR/Cas9 system"     terminator      4128..4190                     /label=RPR1 terminator                     /note="transcription terminator for the S. cerevisiae RNase                     P RNA gene"     rep_origin      4765..5220                     /direction=RIGHT                     /label=f1 ori                     /note="f1 bacteriophage origin of replication; arrow                      indicates direction of (+) strand synthesis"     promoter        5520..5924                     /gene="S. cerevisiae LEU2"                     /label=LEU2 promoter     CDS             5937..7031                     /codon_start=1                     /gene="S. cerevisiae LEU2"                     /product="3-isopropylmalate dehydrogenase, required for                      leucine biosynthesis"                     /label=LEU2                     /note="yeast auxotrophic marker"                     /translation="MSAPKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHL                     IGGAAIDATGVPLPDEALEASKKVDAVLLGAVAGPKWGTGSVRPEQGLLKIRKELQLYA                     NLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYT                     VPEVQRITRMAAFMALQHEPPLPIWSLDKANLLASSRLWRKTVEETIKNEFPTLKVQHQ                     LIDSAAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAF                     GLYEPCHGSAPDLPKNKVDPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRTG                     DLGGSNSTTEVGDAVAEEVKKILA"ORIGIN        1 gacgaaaggg cctcgtgata cgcctatttt tataggttaa tgtcatgata ataatggttt       61 cttagtatga tccaatatca aaggaaatga tagcattgaa ggatgagact aatccaattg      121 aggagtggca gcatatagaa cagctaaagg gtagtgctga aggaagcata cgataccccg      181 catggaatgg gataatatca caggaggtac tagactacct ttcatcctac ataaatagac      241 gcatataagt acgcatttaa gcataaacac gcactatgcc gttcttctca tgtatatata      301 tatacaggca acacgcagat ataggtgcga cgtgaacagt gagctgtatg tgcgcagctc      361 gcgttgcatt ttcggaagcg ctcgttttcg gaaacgcttt gaagttccta ttccgaagtt      421 cctattctct agaaagtata ggaacttcag agcgcttttg aaaaccaaaa gcgctctgaa      481 gacgcacttt caaaaaacca aaaacgcacc ggactgtaac gagctactaa aatattgcga      541 ataccgcttc cacaaacatt gctcaaaagt atctctttgc tatatatctc tgtgctatat      601 ccctatataa cctacccatc cacctttcgc tccttgaact tgcatctaaa ctcgacctct      661 acatttttta tgtttatctc tagtattact ctttagacaa aaaaattgta gtaagaacta      721 ttcatagagt gaatcgaaaa caatacgaaa atgtaaacat ttcctatacg tagtatatag      781 agacaaaata gaagaaaccg ttcataattt tctgaccaat gaagaatcat caacgctatc      841 actttctgtt cacaaagtat gcgcaatcca catcggtata gaatataatc ggggatgcct      901 ttatcttgaa aaaatgcacc cgcagcttcg ctagtaatca gtaaacgcgg gaagtggagt      961 caggcttttt ttatggaaga gaaaatagac accaaagtag ccttcttcta accttaacgg     1021 acctacagtg caaaaagtta tcaagagact gcattataga gcgcacaaag gagaaaaaaa     1081 gtaatctaag atgctttgtt agaaaaatag cgctctcggg atgcattttt gtagaacaaa     1141 aaagaagtat agattctttg ttggtaaaat agcgctctcg cgttgcattt ctgttctgta     1201 aaaatgcagc tcagattctt tgtttgaaaa attagcgctc tcgcgttgca tttttgtttt     1261 acaaaaatga agcacagatt cttcgttggt aaaatagcgc tttcgcgttg catttctgtt     1321 ctgtaaaaat gcagctcaga ttctttgttt gaaaaattag cgctctcgcg ttgcattttt     1381 gttctacaaa atgaagcaca gatgcttcgt tcaggtggca cttttcgggg aaatgtgcgc     1441 ggaaccccta tttgtttatt tttctaaata cattcaaata tgtatccgct catgagacaa     1501 taaccctgat aaatgcttca ataatattga aaaaggaaga gtatgagtat tcaacatttc     1561 cgtgtcgccc ttattccctt ttttgcggca ttttgccttc ctgtttttgc tcacccagaa     1621 acgctggtga aagtaaaaga tgctgaagat cagttgggtg cacgagtggg ttacatcgaa     1681 ctggatctca acagcggtaa gatccttgag agttttcgcc ccgaagaacg ttttccaatg     1741 atgagcactt ttaaagttct gctatgtggc gcggtattat cccgtattga cgccgggcaa     1801 gagcaactcg gtcgccgcat acactattct cagaatgact tggttgagta ctcaccagtc     1861 acagaaaagc atcttacgga tggcatgaca gtaagagaat tatgcagtgc tgccataacc     1921 atgagtgata acactgcggc caacttactt ctgacaacga tcggaggacc gaaggagcta     1981 accgcttttt tgcacaacat gggggatcat gtaactcgcc ttgatcgttg ggaaccggag     2041 ctgaatgaag ccataccaaa cgacgagcgt gacaccacga tgcctgtagc aatggcaacaThere are currently no product reviews.
     Write Review